PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G136900.2.p
Common NameLOC101761243, SETIT_000260mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 881aa    MW: 98035.6 Da    PI: 8.9768
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G136900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.34.2e-094686345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                         W+++E   +++a +++G++ Wk+I+  +g g++  +++s + 
  Seita.5G136900.2.p 46 EWSKDELTCFYEAYRRHGKD-WKKISLAVG-GKSSDMVRSLYS 86
                        7*****************99.*********.*******99665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.1984299IPR017884SANT domain
SMARTSM007170.00134391IPR001005SANT/Myb domain
CDDcd001672.57E-54683No hitNo description
PfamPF002496.3E-84685IPR001005SANT/Myb domain
SuperFamilySSF466896.43E-94690IPR009057Homeodomain-like
PfamPF065844.9E-31506606IPR033471DIRP domain
SMARTSM011358.4E-38506607IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 881 aa     Download sequence    Send to blast
MAPAKGSRTI SKTIIKGYED QQQHDGPPSS SKAKQKKRKI SDLDPEWSKD ELTCFYEAYR  60
RHGKDWKKIS LAVGGKSSDM VRSLYSVHRT FLSLPERQAT AMGFIALVTG HRNASDKSRN  120
LIGDDQMVRA SGKARRRGEA TQQKTTERHD LHDCHEGTIL GFSSSFRKRY YGEFVRNGRN  180
HAVRRRTPRI PVIAPADRNT IDEDTPGTEN IINTTKRKYE AANKDCAIVP TNDCSPDRSS  240
GITETNKAGQ GHTFLETKGT GDTVICQQQL KKARIQQPKE EGQTGKVKNE TVMASDEGNK  300
LVDSLKPHDM LSNIISEDDM LVLDVLNSLV NAPSKTSKLE MNAPSGSHGK TDSALSDRRE  360
EGHPTIDLSK QGKPVGKSSA SKTRKKMRKK LLGAEVLAEA QNISVTNLVL PEAQKVGITD  420
DSSLRTDSAS VGIPEASEDI SAKVPSATLE IKPEIRMSRR TRRKHQMHCK TKHMSCNEDS  480
DNLQAKKLLH CLSSESLRRW CTYEWFYSAV DYPWFSNNEF VHYLDHAKLS HLSRLTRSEW  540
SAIRSSLGKP RRFSDNFLAV EKEKLEDYRE KVRKIYAQLR DGSRDSLPAD LARPFSIGQE  600
VIVRHPSSRE LCDGKVVMMG PDCYKVHFIN PDLGVNIVKD TDCMPVNWLY NRPDNMRRSY  660
LSNNVYNILE TEHIPDLTPS ENWDRAVNGV TVPEQPKSLR LTSDKQLKVE SVVNGERLST  720
SDGPTKSRGG PDNTAGHNDE LESYIAAFVQ RSLSQARQMV DKAMKANSEG SDERVWASNQ  780
ATDSVGPESE SVVCGAQLPS NLISNCIATV LSIKHLSDSR HPPANIAGVL ERVSTMLRPS  840
CPENLAIYKD IETYLSIIAN QILALVPTAL GNCGPPMSPM *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968511.10.0PREDICTED: protein ALWAYS EARLY 2-like
TrEMBLK3XEE30.0K3XEE3_SETIT; Uncharacterized protein
STRINGSi000260m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.22e-64DNA binding